GRA1, Recombinant, Toxoplasma Gondii, aa25-190, His-Tag (Dense Granule Protein 1)

Artikelnummer: USB-373523
Artikelname: GRA1, Recombinant, Toxoplasma Gondii, aa25-190, His-Tag (Dense Granule Protein 1)
Artikelnummer: USB-373523
Hersteller Artikelnummer: 373523
Alternativnummer: USB-373523-20,USB-373523-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa25-190 from Toxoplasma gondii GRA1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.9kD Amino Acid Sequence: AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.9
UniProt: P13403
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.