Gsta1, Recombinant, Rat, aa2-222, His-SUMO-Tag (Glutathione S-transferase alpha-1)

Artikelnummer: USB-373540
Artikelname: Gsta1, Recombinant, Rat, aa2-222, His-SUMO-Tag (Glutathione S-transferase alpha-1)
Artikelnummer: USB-373540
Hersteller Artikelnummer: 373540
Alternativnummer: USB-373540-20,USB-373540-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Source: Recombinant protein corresponding to 2-222 from rat Gsta1, fused to His-SUMO-Tag at N-terminal. expressed in E. coli. Molecular Weight: ~41.5kD Amino Acid Sequence: SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 41.5
UniProt: P00502
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.