GSTA2, Recombinant, Human, aa1-222, GST-Tag (Glutathione S-transferase A2)

Artikelnummer: USB-373541
Artikelname: GSTA2, Recombinant, Human, aa1-222, GST-Tag (Glutathione S-transferase A2)
Artikelnummer: USB-373541
Hersteller Artikelnummer: 373541
Alternativnummer: USB-373541-20, USB-373541-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Source: Recombinant protein corresponding to aa1-222 from human GSTA2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.7kD Amino Acid Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 52.7
UniProt: P09210
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.