GSTK1, Recombinant, Human, aa2-226, GST-Tag (Glutathione S-transferase kappa 1)

Artikelnummer: USB-373543
Artikelname: GSTK1, Recombinant, Human, aa2-226, GST-Tag (Glutathione S-transferase kappa 1)
Artikelnummer: USB-373543
Hersteller Artikelnummer: 373543
Alternativnummer: USB-373543-20,USB-373543-100,USB-373543-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). Recombinant protein corresponding to aa2-226 from human GSTK1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.4kD Amino Acid Sequence: GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL Storage and Stability: Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 52.4
UniProt: Q9Y2Q3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitute to 0.1-1.0mg/ml.