GSTP1, Recombinant, Human, aa2-210, His-Tag (Glutathione S-transferase P)

Artikelnummer: USB-373545
Artikelname: GSTP1, Recombinant, Human, aa2-210, His-Tag (Glutathione S-transferase P)
Artikelnummer: USB-373545
Hersteller Artikelnummer: 373545
Alternativnummer: USB-373545-20, USB-373545-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Recombinant protein corresponding to aa2-210 from human GSTP1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.2kD Amino Acid Sequence: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.2
UniProt: P09211
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol