GSTZ1, Recombinant, Human, aa1-216, GST-Tag (Maleylacetoacetate Isomerase)

Artikelnummer: USB-373549
Artikelname: GSTZ1, Recombinant, Human, aa1-216, GST-Tag (Maleylacetoacetate Isomerase)
Artikelnummer: USB-373549
Hersteller Artikelnummer: 373549
Alternativnummer: USB-373549-20, USB-373549-100, USB-373549-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. Source: Recombinant protein corresponding to aa1-216 from human GSTZ1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~51.1kD Amino Acid Sequence: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 51.1
UniProt: O43708
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.