GTF2A2, Recombinant, Human, aa1-109, GST-Tag (Transcription Initiation Factor IIA Subunit 2)

Artikelnummer: USB-373552
Artikelname: GTF2A2, Recombinant, Human, aa1-109, GST-Tag (Transcription Initiation Factor IIA Subunit 2)
Artikelnummer: USB-373552
Hersteller Artikelnummer: 373552
Alternativnummer: USB-373552-20,USB-373552-100,USB-373552-1
Hersteller: US Biological
Kategorie: Molekularbiologie
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. Source: Recombinant protein corresponding to aa1-109 from human GTF2A2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD Amino Acid Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.5
UniProt: P52657
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.