Hemagglutinin Component HA-17, Recombinant, Clostridium Botulinum, aa2-146, His-Tag (Hemagglutinin Component HA-17)

Artikelnummer: USB-373579
Artikelname: Hemagglutinin Component HA-17, Recombinant, Clostridium Botulinum, aa2-146, His-Tag (Hemagglutinin Component HA-17)
Artikelnummer: USB-373579
Hersteller Artikelnummer: 373579
Alternativnummer: USB-373579-20,USB-373579-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa2-146 from clostridium botluinum Hemagglutinin Component HA-17, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.9kD Amino Acid Sequence: SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.9
UniProt: A7FS59
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.