HADHB, Recombinant, Human, aa35-283, GST-Tag (Trifunctional Enzyme Subunit beta, Mitochondrial)

Artikelnummer: USB-373584
Artikelname: HADHB, Recombinant, Human, aa35-283, GST-Tag (Trifunctional Enzyme Subunit beta, Mitochondrial)
Artikelnummer: USB-373584
Hersteller Artikelnummer: 373584
Alternativnummer: USB-373584-20,USB-373584-100,USB-373584-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Partial recombinant protein corresponding to aa35-283 from human HADHB, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.8kD Amino Acid Sequence: APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 53.8
UniProt: P55084
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.