HAND2, Recombinant, Human, aa1-180, GST-Tag (Heart- and Neural Crest Derivatives-expressed Protein 2)

Artikelnummer: USB-373585
Artikelname: HAND2, Recombinant, Human, aa1-180, GST-Tag (Heart- and Neural Crest Derivatives-expressed Protein 2)
Artikelnummer: USB-373585
Hersteller Artikelnummer: 373585
Alternativnummer: USB-373585-20,USB-373585-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5-CANNTG-3. Source: Recombinant protein corresponding to aa1-180 from human HAND2, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~47.3kD Amino Acid Sequence: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 47.3
UniProt: P61296
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.