Hbb-b2, Recombinant, Mouse, aa2-147, GST-Tag (Hemoglobin Subunit beta-2)

Artikelnummer: USB-373595
Artikelname: Hbb-b2, Recombinant, Mouse, aa2-147, GST-Tag (Hemoglobin Subunit beta-2)
Artikelnummer: USB-373595
Hersteller Artikelnummer: 373595
Alternativnummer: USB-373595-20, USB-373595-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in oxygen transport from the lung to the various peripheral tissues. Source: Recombinant protein corresponding to aa2-147 from mouse Hbb-b2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.7kD Amino Acid Sequence: VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.7
UniProt: P02089
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.