HBXIP, Recombinant, Human, aa1-91, GST-Tag (Hepatitis B Virus X-interacting Protein)

Artikelnummer: USB-373596
Artikelname: HBXIP, Recombinant, Human, aa1-91, GST-Tag (Hepatitis B Virus X-interacting Protein)
Artikelnummer: USB-373596
Hersteller Artikelnummer: 373596
Alternativnummer: USB-373596-20, USB-373596-100, USB-373596-1
Hersteller: US Biological
Kategorie: Molekularbiologie
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication. Source: Recombinant protein corresponding to aa1-91 from human HBXIP, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~36.6kD Amino Acid Sequence: MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.6
UniProt: O43504
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.