HIST1H2BC, Recombinant, Human, aa2-125, GST-Tag (Histone H2B Type 1-C/E/F/G/I)

Produktübersicht

• Artikelname: HIST1H2BC, Recombinant, Human, aa2-125, GST-Tag (Histone H2B Type 1-C/E/F/G/I)
• Artikelnummer: USB-373630
• Hersteller Artikelnummer: 373630
• Alternativnummer: USB-373630-20,USB-373630-100,USB-373630-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid. Source: Recombinant protein corresponding to aa2-125 from human HIST1H2BC, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.6kD Amino Acid Sequence: PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 40.6
• UniProt: P62807
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.