HIST1H2BN, Recombinant, Human, aa2-126, His-SUMO-Tag (Histone H2B Type 1-N)

Produktübersicht

• Artikelname: HIST1H2BN, Recombinant, Human, aa2-126, His-SUMO-Tag (Histone H2B Type 1-N)
• Artikelnummer: USB-373631
• Hersteller Artikelnummer: 373631
• Alternativnummer: USB-373631-20,USB-373631-100,USB-373631-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Source: Recombinant protein corresponding to aa2-126 from human HIST1H2BN, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.8kD Amino Acid Sequence: PEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 29.8
• UniProt: Q99877
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.