Histone H1.0-A, Recombinant, Xenopus Laevis, aa1-194, His-SUMO-Tag (H1f0-a)

Artikelnummer: USB-373633
Artikelname: Histone H1.0-A, Recombinant, Xenopus Laevis, aa1-194, His-SUMO-Tag (H1f0-a)
Artikelnummer: USB-373633
Hersteller Artikelnummer: 373633
Alternativnummer: USB-373633-20,USB-373633-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity). Source: Recombinant protein corresponding to aa1-194 from zenopus laevis Histone H1.0-A, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~37kD Amino Acid Sequence: MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37
UniProt: P22845
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.