Histone H2B Type 1-M, Recombinant, Mouse, aa2-126, His-Tag (Hist1h2bm)

Artikelnummer: USB-373635
Artikelname: Histone H2B Type 1-M, Recombinant, Mouse, aa2-126, His-Tag (Hist1h2bm)
Artikelnummer: USB-373635
Hersteller Artikelnummer: 373635
Alternativnummer: USB-373635-20,USB-373635-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Full-length recombinant protein corresponding to aa2-126 from mouse Histone H2B type 1-M, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: P10854 Molecular Weight: ~17.8kD Amino Acid Sequence: PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.8
UniProt: P10854
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol.