HLA-E, Recombinant, Human, aa22-305, His-SUMO-Tag (HLA Class I Histocompatibility Antigen, Alpha Chain E)
Artikelnummer:
USB-373649
Hersteller Artikelnummer:
373649
Alternativnummer:
USB-373649-20, USB-373649-100, USB-373649-1
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules. Partial recombinant protein corresponding to aa22-305 from human HLA-E, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.7kD Amino Acid Sequence: GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten