Hly, Recombinant, Staphylococcus aureus, aa27-319, His-SUMO-Tag (Alpha-Hemolysin)

Artikelnummer: USB-373650
Artikelname: Hly, Recombinant, Staphylococcus aureus, aa27-319, His-SUMO-Tag (Alpha-Hemolysin)
Artikelnummer: USB-373650
Hersteller Artikelnummer: 373650
Alternativnummer: USB-373650-20,USB-373650-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity. Source: Recombinant protein corresponding to aa27-319 from staphylococcus aureus hly, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~49.3kD Amino Acid Sequence: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.3
UniProt: Q2G1X0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.