HMGB1, Recombinant, Human, aa8-179, GST-Tag (High Mobility Group Protein B1)
Artikelnummer:
USB-373652
Hersteller Artikelnummer:
373652
Alternativnummer:
USB-373652-20, USB-373652-100, USB-373652-1
Hersteller:
US Biological
Kategorie:
Molekularbiologie
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic domain processes in developing cells. Recombinant protein corresponding to aa8-179 from human HMGB1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.7kD Amino Acid Sequence: KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
