HMGN4, Recombinant, Human, aa1-90, GST-Tag (High Mobility Group Nucleosome-binding Domain-containing Protein 4)

Artikelnummer: USB-373657
Artikelname: HMGN4, Recombinant, Human, aa1-90, GST-Tag (High Mobility Group Nucleosome-binding Domain-containing Protein 4)
Artikelnummer: USB-373657
Hersteller Artikelnummer: 373657
Alternativnummer: USB-373657-20, USB-373657-100, USB-373657-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Non-histone chromosomal protein HMG-17-like 3. Source: Recombinant protein corresponding to aa1-90 from human HMGN4, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~36.5kD Amino Acid Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.5
UniProt: O00479
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.