HNRNPA2B1, Recombinant, Human, aa1-249, His-Tag (Heterogeneous Nuclear Ribonucleoproteins A2/B1)

Artikelnummer: USB-373665
Artikelname: HNRNPA2B1, Recombinant, Human, aa1-249, His-Tag (Heterogeneous Nuclear Ribonucleoproteins A2/B1)
Artikelnummer: USB-373665
Hersteller Artikelnummer: 373665
Alternativnummer: USB-373665-20,USB-373665-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved with pre-mRNA processing. Forms complexes (ribonucleosomes) with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Source: Recombinant protein corresponding to aa1-249 from human HNRNPA2B1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.4kD Amino Acid Sequence: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.4
UniProt: P22626
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.