HPRT1, Recombinant, Human, aa2-218, His-Tag (Hypoxanthine-guanine phosphoribosyltransferase)

Artikelnummer: USB-373679
Artikelname: HPRT1, Recombinant, Human, aa2-218, His-Tag (Hypoxanthine-guanine phosphoribosyltransferase)
Artikelnummer: USB-373679
Hersteller Artikelnummer: 373679
Alternativnummer: USB-373679-20,USB-373679-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway. Source: Recombinant protein corresponding to aa2-218 from human HPRT1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.5kD Amino Acid Sequence: ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.5
UniProt: P00492
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.