HSBP1, Recombinant, Human, aa1-75, GST-Tag (Heat Shock Factor-binding Protein 1)
Artikelnummer:
USB-373685
Hersteller Artikelnummer:
373685
Alternativnummer:
USB-373685-20,USB-373685-100,USB-373685-1
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process. Source: Recombinant protein corresponding to aa1-75 from human HSBP1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~35.5kD Amino Acid Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten