HSP70, Recombinant, Alternaria alternata, aa1-152, His-Tag (Heat Shock 70kD Protein)

Produktübersicht

• Artikelname: HSP70, Recombinant, Alternaria alternata, aa1-152, His-Tag (Heat Shock 70kD Protein)
• Artikelnummer: USB-373692
• Hersteller Artikelnummer: 373692
• Alternativnummer: USB-373692-20, USB-373692-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-152 from alternaria alternata HSP70, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.2kD Amino Acid Sequence: KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 20.2
• UniProt: P78983
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.