HSP70, Recombinant, Alternaria Alternata, aa1-152, His-Tag (Heat Shock 70kD Protein)

Artikelnummer: USB-373693
Artikelname: HSP70, Recombinant, Alternaria Alternata, aa1-152, His-Tag (Heat Shock 70kD Protein)
Artikelnummer: USB-373693
Hersteller Artikelnummer: 373693
Alternativnummer: USB-373693-20,USB-373693-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-152 from alternaria alternata HSP70, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.2kD Amino Acid Sequence: KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.2
UniProt: P78983
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.