IagB, Recombinant, Salmonella Typhimurium, aa20-160, His-SUMO-Tag (Invasion Protein IagB)

Artikelnummer: USB-373717
Artikelname: IagB, Recombinant, Salmonella Typhimurium, aa20-160, His-SUMO-Tag (Invasion Protein IagB)
Artikelnummer: USB-373717
Hersteller Artikelnummer: 373717
Alternativnummer: USB-373717-20, USB-373717-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa20-160 from salmonella typhimurium IagB, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~32kD Amino Acid Sequence: DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32
UniProt: P0CL15
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.