IFNA14, Recombinant, Human, aa24-189, His-Tag (Interferon alpha-14)

Artikelnummer: USB-373745
Artikelname: IFNA14, Recombinant, Human, aa24-189, His-Tag (Interferon alpha-14)
Artikelnummer: USB-373745
Hersteller Artikelnummer: 373745
Alternativnummer: USB-373745-20, USB-373745-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Source: Recombinant protein corresponding to aa24-189 from human IFNA14, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.7kD Amino Acid Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.7
UniProt: P01570
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.