IFNA2, Recombinant, Human, aa24-188, His-Tag (Interferon alpha-2)

Artikelnummer: USB-373747
Artikelname: IFNA2, Recombinant, Human, aa24-188, His-Tag (Interferon alpha-2)
Artikelnummer: USB-373747
Hersteller Artikelnummer: 373747
Alternativnummer: USB-373747-20,USB-373747-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Produced by macrophages, IFN-alpha have antiviral activities. Source: Recombinant protein corresponding to aa24-188 from human IFNA2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~21.2kD Amino Acid Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.2
UniProt: P01563
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.