IFNAR2, Recombinant, Mouse, aa22-242, His-Tag (Interferon alpha/beta Receptor 2)

Artikelnummer: USB-373754
Artikelname: IFNAR2, Recombinant, Mouse, aa22-242, His-Tag (Interferon alpha/beta Receptor 2)
Artikelnummer: USB-373754
Hersteller Artikelnummer: 373754
Alternativnummer: USB-373754-20,USB-373754-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and 3 may be potent inhibitors of type I IFN receptor activity. Source: Recombinant protein corresponding to aa22-242 from mouse IFNAR2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.76kD Amino Acid Sequence: SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.76
UniProt: O35664
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.