IFT27, Recombinant, Human, aa1-186, His-SUMO-Tag (Intraflagellar Transport Protein 27 Homolog)

Artikelnummer: USB-373765
Artikelname: IFT27, Recombinant, Human, aa1-186, His-SUMO-Tag (Intraflagellar Transport Protein 27 Homolog)
Artikelnummer: USB-373765
Hersteller Artikelnummer: 373765
Alternativnummer: USB-373765-20,USB-373765-100,USB-373765-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6. Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6. Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25. Source: Recombinant protein corresponding to aa1-186 from human IFT27, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.5kD Amino Acid Sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.5
UniProt: Q9BW83
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.