IL17A, Recombinant, Macaca Mulatta (Rhesus Macaque), aa24-155, GST-Tag (Uncharacterized Protein)

Artikelnummer: USB-373793
Artikelname: IL17A, Recombinant, Macaca Mulatta (Rhesus Macaque), aa24-155, GST-Tag (Uncharacterized Protein)
Artikelnummer: USB-373793
Hersteller Artikelnummer: 373793
Alternativnummer: USB-373793-20,USB-373793-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa24-155 from Macaca Mulatta (Rhesus Macaque) IL17A, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.1kD Amino Acid Sequence: GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 42.1
UniProt: F6T3G5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.