Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A Protein)

Artikelnummer: USB-373794
Artikelname: Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A Protein)
Artikelnummer: USB-373794
Hersteller Artikelnummer: 373794
Alternativnummer: USB-373794-20,USB-373794-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD Amino Acid Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.3
UniProt: G1SLF2
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.