Il18, Recombinant, Rat, aa37-194, His-Tag (Interleukin-18)

Produktübersicht

• Artikelname: Il18, Recombinant, Rat, aa37-194, His-Tag (Interleukin-18)
• Artikelnummer: USB-373796
• Hersteller Artikelnummer: 373796
• Alternativnummer: USB-373796-20,USB-373796-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells. Source: Recombinant protein corresponding to aa37-194 from rat Interleukin-18, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.3kD Amino Acid Sequence: HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 22.3
• UniProt: P97636
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.