Il1f10, Recombinant, Mouse, aa1-152, His-Tag (Interleukin-1 Family Member 10)

Produktübersicht

• Artikelname: Il1f10, Recombinant, Mouse, aa1-152, His-Tag (Interleukin-1 Family Member 10)
• Artikelnummer: USB-373809
• Hersteller Artikelnummer: 373809
• Alternativnummer: USB-373809-20,USB-373809-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2 (By similarity). Source: Recombinant protein corresponding to aa1-152 from mouse If10, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.1kD Amino Acid Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 19.1
• UniProt: Q8R459
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.