IL37, Recombinant, Human, aa1-218, GST-Tag (Interleukin-37)

Artikelnummer: USB-373824
Artikelname: IL37, Recombinant, Human, aa1-218, GST-Tag (Interleukin-37)
Artikelnummer: USB-373824
Hersteller Artikelnummer: 373824
Alternativnummer: USB-373824-20,USB-373824-100,USB-373824-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. Source: Full length recombinant protein corresponding to aa1-218 from human IL37, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.1kD Amino Acid Sequence: MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 51.1
UniProt: Q9NZH6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.