ILDR2, Recombinant, Human, aa1-186, GST-Tag (Immunoglobulin-like Domain-containing Receptor 2)

Artikelnummer: USB-373840
Artikelname: ILDR2, Recombinant, Human, aa1-186, GST-Tag (Immunoglobulin-like Domain-containing Receptor 2)
Artikelnummer: USB-373840
Hersteller Artikelnummer: 373840
Alternativnummer: USB-373840-20,USB-373840-100,USB-373840-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in lipid homeostasis and ER stress pathways. Source: Recombinant protein corresponding to aa1-186 from human ILDR2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.1kD Amino Acid Sequence: MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 48.1
UniProt: Q71H61
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.