ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)

Produktübersicht

• Artikelname: ILDR2, Recombinant, Human, aa1-186, His-Tag (Immunoglobulin-like Domain-containing Receptor 2)
• Artikelnummer: USB-373841
• Hersteller Artikelnummer: 373841
• Alternativnummer: USB-373841-20,USB-373841-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May be involved in lipid homeostasis and ER stress pathways. Source: Recombinant protein corresponding to aa1-186 from human ILDR2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~23.1kD Amino Acid Sequence: MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 23.1
• UniProt: Q71H61
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.