Interferon gamma, Recombinant, Human, aa24-161, His-Tag (IFNG)

Artikelnummer: USB-373856
Artikelname: Interferon gamma, Recombinant, Human, aa24-161, His-Tag (IFNG)
Artikelnummer: USB-373856
Hersteller Artikelnummer: 373856
Alternativnummer: USB-373856-20,USB-373856-100,USB-373856-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Source: Recombinant protein corresponding to aa24-161 from human Interferon gamma, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.2kD Amino Acid Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.2
UniProt: P01579
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.