Irf5, Recombinant, Mouse, aa1-263, His-SUMO-Tag (Interferon regulatory Factor 5)

Artikelnummer: USB-373862
Artikelname: Irf5, Recombinant, Mouse, aa1-263, His-SUMO-Tag (Interferon regulatory Factor 5)
Artikelnummer: USB-373862
Hersteller Artikelnummer: 373862
Alternativnummer: USB-373862-20,USB-373862-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling. Recombinant protein corresponding to aa1-263 from mouse Irf5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~72kD Amino Acid Sequence: MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 72
UniProt: P56477
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol