ITIH5, Recombinant, Human, aa35-161, His-SUMO-Tag (Inter-alpha-trypsin Inhibitor Heavy Chain H5)

Artikelnummer: USB-373879
Artikelname: ITIH5, Recombinant, Human, aa35-161, His-SUMO-Tag (Inter-alpha-trypsin Inhibitor Heavy Chain H5)
Artikelnummer: USB-373879
Hersteller Artikelnummer: 373879
Alternativnummer: USB-373879-20,USB-373879-100,USB-373879-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May act as a tumor suppressor. Source: Partial recombinant protein corresponding to aa35-161 from human ITIH5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.6kD Amino Acid Sequence: VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.6
UniProt: Q86UX2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.