IZUMO1R, Recombinant, Human, aa20-250, His-Tag (Sperm-egg Fusion Protein Juno)

Artikelnummer: USB-373881
Artikelname: IZUMO1R, Recombinant, Human, aa20-250, His-Tag (Sperm-egg Fusion Protein Juno)
Artikelnummer: USB-373881
Hersteller Artikelnummer: 373881
Alternativnummer: USB-373881-20,USB-373881-100,USB-373881-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane fusogen. Does not bind folate (By similarity). Source: Recombinant protein corresponding to aa20-250 from human IZUMO1R, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~30.3kD Amino Acid Sequence: GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.3
UniProt: A6ND01
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.