JAM2, Recombinant, Human, aa29-238, His-Tag (Junctional Adhesion Molecule B)

Artikelnummer: USB-373890
Artikelname: JAM2, Recombinant, Human, aa29-238, His-Tag (Junctional Adhesion Molecule B)
Artikelnummer: USB-373890
Hersteller Artikelnummer: 373890
Alternativnummer: USB-373890-20,USB-373890-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in the processes of lymphocyte homing to secondary lymphoid organs. Source: Recombinant protein corresponding to aa29-238 from human JAM2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.4kD Amino Acid Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.4
UniProt: P57087
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.