Klkb1, Recombinant, Rat, aa391-638, His-Tag (Plasma Kallikrein)

Artikelnummer: USB-373938
Artikelname: Klkb1, Recombinant, Rat, aa391-638, His-Tag (Plasma Kallikrein)
Artikelnummer: USB-373938
Hersteller Artikelnummer: 373938
Alternativnummer: USB-373938-20,USB-373938-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa391-638 from rat Klkb1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.8kD Amino Acid Sequence: IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.8
UniProt: P14272
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.