KNG1, Recombinant, Human, aa390-644, His-Tag (Kininogen-1)

Artikelnummer: USB-373944
Artikelname: KNG1, Recombinant, Human, aa390-644, His-Tag (Kininogen-1)
Artikelnummer: USB-373944
Hersteller Artikelnummer: 373944
Alternativnummer: USB-373944-20,USB-373944-100,USB-373944-1
Hersteller: US Biological
Kategorie: Molekularbiologie
1 Kininogens are inhibitors of thiol proteases, (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII, (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes, (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action), (5) LMW-kininogen inhibits the aggregation of thrombocytes, (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting. Source: Recombinant protein corresponding to aa390-644 from human Kininogen-1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.2kD Amino Acid Sequence: SSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.2
UniProt: P01042
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.