LAG3, Recombinant, Human, aa29-450, GST-Tag (Lymphocyte Activation Gene 3 Protein)

Artikelnummer: USB-373979
Artikelname: LAG3, Recombinant, Human, aa29-450, GST-Tag (Lymphocyte Activation Gene 3 Protein)
Artikelnummer: USB-373979
Hersteller Artikelnummer: 373979
Alternativnummer: USB-373979-20,USB-373979-100,USB-373979-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in lymphocyte activation. Binds to HLA class-II antigens. Recombinant protein corresponding to aa29-450 from human LAG3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~75.6kD Amino Acid Sequence: VPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 75.6
UniProt: P18627
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.