LAMTOR3, Recombinant, Human, aa1-124, GST-Tag (Ragulator Complex Protein LAMTOR3)
Artikelnummer:
USB-373984
Hersteller Artikelnummer:
373984
Alternativnummer:
USB-373984-20,USB-373984-100,USB-373984-1
Hersteller:
US Biological
Kategorie:
Molekularbiologie
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2. Full length recombinant protein corresponding to aa1-124 from human LAMTOR3, fused to GST-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accessionr: Q9UHA4. Molecular Weight: ~40.6kD Amino Acid Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.