LARP1B, Recombinant, Human, aa1-201, His-SUMO-Tag (La-related Protein 1B)

Artikelnummer: USB-373986
Artikelname: LARP1B, Recombinant, Human, aa1-201, His-SUMO-Tag (La-related Protein 1B)
Artikelnummer: USB-373986
Hersteller Artikelnummer: 373986
Alternativnummer: USB-373986-20,USB-373986-100,USB-373986-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-201 from human LARP1B, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.1kD Amino Acid Sequence: MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 40.1
UniProt: Q659C4
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.