LASP1, Recombinant, Human, aa1-243, GST-Tag (LIM and SH3 Domain Protein 1)

Produktübersicht

• Artikelname: LASP1, Recombinant, Human, aa1-243, GST-Tag (LIM and SH3 Domain Protein 1)
• Artikelnummer: USB-373988
• Hersteller Artikelnummer: 373988
• Alternativnummer: USB-373988-20,USB-373988-100,USB-373988-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types. Source: Partial recombinant protein corresponding to aa1-243 from human LASP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.8kD Amino Acid Sequence: MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 54.8
• UniProt: Q14847
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.