LCR83, Recombinant, Arabidopsis Thaliana, aa28-82, GST-Tag (Putative Defensin-like Protein 70)

Produktübersicht

• Artikelname: LCR83, Recombinant, Arabidopsis Thaliana, aa28-82, GST-Tag (Putative Defensin-like Protein 70)
• Artikelnummer: USB-373996
• Hersteller Artikelnummer: 373996
• Alternativnummer: USB-373996-20,USB-373996-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa28-82 from arabidopsis thaliana LCR83, fused to GST-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~32.9kD Amino Acid Sequence: NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32.9
• UniProt: P82792
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.