LCR83, Recombinant, Arabidopsis Thaliana, aa28-82, GST-Tag (Putative Defensin-like Protein 70)

Artikelnummer: USB-373996
Artikelname: LCR83, Recombinant, Arabidopsis Thaliana, aa28-82, GST-Tag (Putative Defensin-like Protein 70)
Artikelnummer: USB-373996
Hersteller Artikelnummer: 373996
Alternativnummer: USB-373996-20,USB-373996-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa28-82 from arabidopsis thaliana LCR83, fused to GST-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~32.9kD Amino Acid Sequence: NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.9
UniProt: P82792
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.