MDR1, Recombinant, Entamoeba Histolytica, aa1-114, His-Tag (Multidrug Resistance Protein 1)

Artikelnummer: USB-374181
Artikelname: MDR1, Recombinant, Entamoeba Histolytica, aa1-114, His-Tag (Multidrug Resistance Protein 1)
Artikelnummer: USB-374181
Hersteller Artikelnummer: 374181
Alternativnummer: USB-374181-20,USB-374181-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. Source: Recombinant protein corresponding to aa1-114 from entamoeba histolytica MDR1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.49kD Amino Acid Sequence: SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.49
UniProt: P16875
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.